PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10015296m
Common NameEUTSA_v10015296mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family ARR-B
Protein Properties Length: 628aa    MW: 70030.2 Da    PI: 5.5852
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10015296mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.82.9e-29185238155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kpr++W++eLH++Fv+av+qL G +kA+Pk+il++m+++gLt+e+v+SHLQkYRl
  Thhalv10015296m 185 KPRVVWSQELHQKFVNAVQQL-GLDKAVPKKILDFMNIEGLTRENVASHLQKYRL 238
                      79*******************.********************************8 PP

2Response_reg69.41.5e-2331101109
                      EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHT CS
     Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealka 92 
                      vl vdD+p+ ++ l+++l + +y +v+ + ++++alell+ek   +Dl++ D+emp+ dG++ll+   e  ++lp+i+++ah++ + + + +  
  Thhalv10015296m   3 VLAVDDNPTCLRKLEELLLRCKY-HVTKTMESKKALELLREKSnmFDLVISDVEMPDTDGFKLLEIGLE--MDLPVIMLSAHSDYDSVMKGIIH 93 
                      799********************.***************999999******************985344..57********************* PP

                      TESEEEESS--HHHHHH CS
     Response_reg  93 GakdflsKpfdpeelvk 109
                      Ga d+l+Kp+  +el++
  Thhalv10015296m  94 GACDYLVKPVGLKELRN 110
                      **************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521724.27E-301119IPR011006CheY-like superfamily
SMARTSM004482.3E-261112IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23001.4E-331139No hitNo description
PIRSFPIRSF0363922.1E-1621626IPR017053Response regulator B-type, plant
PROSITE profilePS5011038.4372116IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.1E-213111IPR001789Signal transduction response regulator, receiver domain
CDDcd001569.55E-2025115No hitNo description
SuperFamilySSF466892.24E-20182242IPR009057Homeodomain-like
PROSITE profilePS5129411.787182241IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-29183243IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-26185238IPR006447Myb domain, plants
PfamPF002495.0E-9187237IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009736Biological Processcytokinin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 628 aa     Download sequence    Send to blast
MRVLAVDDNP TCLRKLEELL LRCKYHVTKT MESKKALELL REKSNMFDLV ISDVEMPDTD  60
GFKLLEIGLE MDLPVIMLSA HSDYDSVMKG IIHGACDYLV KPVGLKELRN IWQHVVKKNI  120
TTYKKNISPS PQLLTPSESH LAPSGSKKRK EKVNDSGGDE DESDREDEDG EGSEQDGDES  180
STRKKPRVVW SQELHQKFVN AVQQLGLDKA VPKKILDFMN IEGLTRENVA SHLQKYRLYL  240
KKIDESQHQN MTPDTFGTKD SSYFNMSQLD GLRDFTSTRQ FPSSSLLSRS HLTRFHPSVY  300
SSINLQGTNS SNFNNHQSSS NSANPFGTYH RTLFPRSQNV NLSPLEPLQF PTSKYMGDFK  360
TIGDRATGGS FLDTRMSFGS SSTSLPSASS NNLMLQANYT QPLHIASDKN QPCHEANSSS  420
LNMSVHGLPR FPSHSWQGSL RTTNRFPSSC LPINHVFSQD QVAYPGSGLG DCSSLVSAEN  480
PGGEMQCEPQ LLGAFMNTLD DGPKWEEQNC NMVNNQFGNV EYPLAADNIV FRDNNASRSK  540
GLDESLMMSP IEDSATTINN SQEYVGKFTM LDADQMKHSG KPENALVVEN QHDVFDDIMN  600
EMMKQDENNG LVSAVATRFG FDSFPPP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-23181243163ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00057PBMTransfer from AT5G58080Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006401132.10.0hypothetical protein EUTSA_v10015296mg
SwissprotQ9FGT70.0ARR18_ARATH; Two-component response regulator ARR18
TrEMBLV4KX720.0V4KX72_EUTSA; Uncharacterized protein
STRINGAl_scaffold_0008_22760.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM142821823
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58080.10.0response regulator 18